General Information

  • ID:  hor005496
  • Uniprot ID:  P12705
  • Protein name:  Insulin A chain
  • Gene name:  ins
  • Organism:  Torpedo marmorata (Marbled electric ray)
  • Family:  insulin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Torpedo (genus), Torpedinidae (family), Torpediniformes (order), Batoidea (superorder), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GIVEHCCHNTCSLFDLEGYCN
  • Length:  21(50-70)
  • Propeptide:  LPSQHLCGSHLVEALYFVCGPKGFYYLPKAXXFVDSLAGYSKHQNGGISGIVEHCCHNTCSLFDLEGYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45819
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005496_AF2.pdbhor005496_ESM.pdb

Physical Information

Mass: 271457 Formula: C98H145N27O33S4
Absent amino acids: AKMPQRW Common amino acids: C
pI: 4.42 Basic residues: 2
Polar residues: 11 Hydrophobic residues: 5
Hydrophobicity: 7.62 Boman Index: -2227
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 69.52
Instability Index: 2243.81 Extinction Coefficient cystines: 1740
Absorbance 280nm: 87

Literature

  • PubMed ID:  3549433
  • Title:  Primary structure of insulin and a truncated C-peptide from an elasmobranchian fish, Torpedo marmorata.