HORDB

ID: hor005496
Uniprot ID: P12705
Protein name: Insulin A chain
Gene name: ins
Organism: Torpedo marmorata (Marbled electric ray)
Family: insulin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Torpedo (genus), Torpedinidae (family), Torpediniformes (order), Batoidea (superorder), Elasmobranchii (subclass), Chondrichthyes (class), Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
GO CC: GO:0005576 extracellular region

Sequence: GIVEHCCHNTCSLFDLEGYCN
Length: 21(50-70)
Propeptide: LPSQHLCGSHLVEALYFVCGPKGFYYLPKAXXFVDSLAGYSKHQNGGISGIVEHCCHNTCSLFDLEGYCN
Signal peptide: NA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005496_AF2.pdb

hor005496_ESM.pdb

Mass:	271457	Formula:	C98H145N27O33S4
Absent amino acids:	AKMPQRW	Common amino acids:	C
pI:	4.42	Basic residues:	2
Polar residues:	11	Hydrophobic residues:	5
Hydrophobicity:	7.62	Boman Index:	-2227
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.52
Instability Index:	2243.81	Extinction Coefficient cystines:	1740
Absorbance 280nm:	87

PubMed ID: 3549433
Title: Primary structure of insulin and a truncated C-peptide from an elasmobranchian fish, Torpedo marmorata.